PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C013364P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 251aa    MW: 28068.9 Da    PI: 8.8913
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C013364P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding544e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ ++k +G g+W++ ++  g+ R++k+c++rw +yl
   MELO3C013364P1 14 KGAWTKEEDDRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding55.71.1e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+ Ed+l+++++ +lG++ W++Ia +++ gRt++++k++w+++
   MELO3C013364P1  67 RGNFTQHEDDLIIKLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.745961IPR017930Myb domain
SMARTSM007171.2E-131363IPR001005SANT/Myb domain
SuperFamilySSF466891.84E-2913108IPR009057Homeodomain-like
PfamPF002493.3E-151461IPR001005SANT/Myb domain
CDDcd001675.21E-111661No hitNo description
PROSITE profilePS5129427.04862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2765116IPR009057Homeodomain-like
SMARTSM007176.2E-1766114IPR001005SANT/Myb domain
PfamPF002492.2E-1567111IPR001005SANT/Myb domain
CDDcd001672.74E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDDRLIAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TQHEDDLIIK LHSLLGNRWS LIAGRLPGRT DNEIKNYWNT HIKRKLLSRG  120
IDPTTHRPIT DSSSVKTPAT TISFASNSGL EDQEDRKKPV INNFSPPKEE ELLDLNLDLR  180
ISPPPYPTAM TIKNEVRNSL CFFCSLGFEN SKNCSCGNGK ISASSDSNGN GYDFLGLKSC  240
VLDCRSLEIK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817980.0LN681798.1 Cucumis melo genomic scaffold, anchoredscaffold00019.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008447966.10.0PREDICTED: myb-related protein 308-like
SwissprotP813931e-111MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A0A0K4N01e-154A0A0A0K4N0_CUCSA; MYB domain class transcription factor
STRINGSolyc10g055410.1.11e-111(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.12e-99myb domain protein 4